| Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.8: G proteins [52592] (78 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
| Protein Transducin (alpha subunit) [52623] (3 species) common fold is interrupted with an all-alpha domain |
| Species Cow (Bos taurus) [TaxId:9913] [52624] (15 PDB entries) |
| Domain d1u0hc2: 1u0h C:39-65,C:202-388 [112919] Other proteins in same PDB: d1u0ha_, d1u0hb_, d1u0hc1 complexed with cl, fok, gsp, mg, onm |
PDB Entry: 1u0h (more details), 2.9 Å
SCOP Domain Sequences for d1u0hc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u0hc2 c.37.1.8 (C:39-65,C:202-388) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]}
athrllllgagesgkstivkqmrilhvXvltsgifetkfqvdkvnfhmfdvggqrderrk
wiqcfndvtaiifvvasssynmvirednqtnrlqealnlfksiwnnrwlrtisvilflnk
qdllaekvlagkskiedyfpefaryttpedatpepgedprvtrakyfirdeflristasg
dgrhycyphftcavdtenirrvfndcrdiiqrmhl
Timeline for d1u0hc2: