SCOP 1.73: Domain d1u0hb_: 1u0h B:

Lineage for d1u0hb_ (1u0h B:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.29: Nucleotide cyclase [55073] (2 families)
   common fold is elaborated with additional secondary structures

5. Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (5 proteins)
   Pfam PF00211
   structurally similar to the "palm" domain of DNA/RNA polymerase superfamily

6. Protein Type II adenylyl cyclase C2 domain [55075] (1 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [55076] (5 PDB entries)

8. Domain d1u0hb_: 1u0h B: [112917]
   Other proteins in same PDB: d1u0ha_, d1u0hc1, d1u0hc2
   complexed with cl, fok, gsp, mg, onm

Details for d1u0hb_

PDB Entry: 1u0h, 2.9 Å

PDB Description: structural basis for the inhibition of mammalian adenylyl cyclase by mant-gtp

PDB Compounds: (B:) adenylate cyclase, type II

SCOP Domain Sequences for d1u0hb_:

Sequence, based on SEQRES records:

>d1u0hb_ d.58.29.1 (B:) Type II adenylyl cyclase C2 domain {Rat (Rattus norvegicus) [TaxId: 10116]}
hqsydcvcvmfasipdfkefytesdvnkegleclrllneiiadfddllskpkfsgvekik
tigstymaatglsaipsqehaqeperqymhigtmvefayalvgkldainkhsfndfklrv
ginhgpviagvigaqkpqydiwgntvnvasrmdstgvldkiqvteetslilqtlgytctc
rgiinvkgkgdlktyfvnt

Sequence, based on observed residues (ATOM records):

>d1u0hb_ d.58.29.1 (B:) Type II adenylyl cyclase C2 domain {Rat (Rattus norvegicus) [TaxId: 10116]}
hqsydcvcvmfasipdfkefytesdvnkegleclrllneiiadfddllskpkfsgvekik
tigstymaatglsairqymhigtmvefayalvgkldainkhsfndfklrvginhgpviag
vigaqkpqydiwgntvnvasrmdstgvldkiqvteetslilqtlgytctcrgiinvkgkg
dlktyfvnt

Timeline for d1u0hb_:

• d1u0hb_ first appeared in SCOP 1.71
  
• d1u0hb_ appears in SCOP 1.75
  
• d1u0hb_ appears in the current release, SCOPe 2.08