Lineage for d1u0ha_ (1u0h A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 725665Superfamily d.58.29: Nucleotide cyclase [55073] (2 families) (S)
    common fold is elaborated with additional secondary structures
  5. 725666Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (5 proteins)
    Pfam PF00211
    structurally similar to the "palm" domain of DNA/RNA polymerase superfamily
  6. 725694Protein Adenylyl cyclase VC1, domain C1a [55077] (1 species)
  7. 725695Species Dog (Canis familiaris) [TaxId:9615] [55078] (11 PDB entries)
  8. 725705Domain d1u0ha_: 1u0h A: [112916]
    Other proteins in same PDB: d1u0hb_, d1u0hc1, d1u0hc2
    complexed with cl, fok, gsp, mg, onm

Details for d1u0ha_

PDB Entry: 1u0h (more details), 2.9 Å

PDB Description: structural basis for the inhibition of mammalian adenylyl cyclase by mant-gtp
PDB Compounds: (A:) adenylate cyclase, type v

SCOP Domain Sequences for d1u0ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u0ha_ d.58.29.1 (A:) Adenylyl cyclase VC1, domain C1a {Dog (Canis familiaris) [TaxId: 9615]}
mmfhkiyiqkhdnvsilfadiegftslasqctaqelvmtlnelfarfdklaaenhclrik
ilgdcyycvsglpearadhahccvemgmdmieaislvremtgvnvnmrvgihsgrvhcgv
lglrkwqfdvwsndvtlanhmeaggkagrihitkatlsylngdyevepgcggernaylke
hsietflil

SCOP Domain Coordinates for d1u0ha_:

Click to download the PDB-style file with coordinates for d1u0ha_.
(The format of our PDB-style files is described here.)

Timeline for d1u0ha_: