SCOPe 2.06: Domain d1tzzb2: 1tzz B:2005-2145

Lineage for d1tzzb2 (1tzz B:2005-2145)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
   C-terminal domain is beta/alpha-barrel

6. Protein Hypothetical protein Bll6730 [117927] (1 species)

7. Species Bradyrhizobium japonicum [TaxId:375] [117928] (1 PDB entry)
   Uniprot Q89FH0

8. Domain d1tzzb2: 1tzz B:2005-2145 [112899]
   Other proteins in same PDB: d1tzza1, d1tzzb1
   Structural genomics target
   complexed with mg

Details for d1tzzb2

PDB Entry: 1tzz, 1.86 Å

PDB Description: crystal structure of the protein l1841, unknown member of enolase superfamily from bradyrhizobium japonicum

PDB Compounds: (B:) Hypothetical protein L1841

SCOPe Domain Sequences for d1tzzb2:

Sequence, based on SEQRES records:

>d1tzzb2 d.54.1.1 (B:2005-2145) Hypothetical protein Bll6730 {Bradyrhizobium japonicum [TaxId: 375]}
svrivdvreitkpisspirnayidftkmttslvavvtdvvregkrvvgygfnsngrygqg
glirerfasrileadpkkllneagdnldpdkvwaamminekpgghgersvavgtidmavw
davakiagkplfrllaerhgv

Sequence, based on observed residues (ATOM records):

>d1tzzb2 d.54.1.1 (B:2005-2145) Hypothetical protein Bll6730 {Bradyrhizobium japonicum [TaxId: 375]}
svrivdvreitkpisstkmttslvavvtdvvregkrvvgygfnsngrygqgglirerfas
rileadpkkllneagdnldpdkvwaamminekpgghgersvavgtidmavwdavakiagk
plfrllaerhgv

Timeline for d1tzzb2:

• d1tzzb2 first appeared in SCOP 1.71
  
• d1tzzb2 appears in SCOPe 2.05
  
• d1tzzb2 appears in SCOPe 2.07
  
• d1tzzb2 appears in the current release, SCOPe 2.08