Lineage for d1tzzb2 (1tzz B:2005-2145)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 602849Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 602850Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) (S)
  5. 602851Family d.54.1.1: Enolase N-terminal domain-like [54827] (12 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 602940Protein Hypothetical protein Bll6730 [117927] (1 species)
  7. 602941Species Bradyrhizobium japonicum [TaxId:375] [117928] (1 PDB entry)
  8. 602943Domain d1tzzb2: 1tzz B:2005-2145 [112899]
    Other proteins in same PDB: d1tzza1, d1tzzb1
    Structural genomics target
    complexed with mg

Details for d1tzzb2

PDB Entry: 1tzz (more details), 1.86 Å

PDB Description: crystal structure of the protein l1841, unknown member of enolase superfamily from bradyrhizobium japonicum

SCOP Domain Sequences for d1tzzb2:

Sequence, based on SEQRES records: (download)

>d1tzzb2 d.54.1.1 (B:2005-2145) Hypothetical protein Bll6730 {Bradyrhizobium japonicum}
svrivdvreitkpisspirnayidftkmttslvavvtdvvregkrvvgygfnsngrygqg
glirerfasrileadpkkllneagdnldpdkvwaamminekpgghgersvavgtidmavw
davakiagkplfrllaerhgv

Sequence, based on observed residues (ATOM records): (download)

>d1tzzb2 d.54.1.1 (B:2005-2145) Hypothetical protein Bll6730 {Bradyrhizobium japonicum}
svrivdvreitkpisstkmttslvavvtdvvregkrvvgygfnsngrygqgglirerfas
rileadpkkllneagdnldpdkvwaamminekpgghgersvavgtidmavwdavakiagk
plfrllaerhgv

SCOP Domain Coordinates for d1tzzb2:

Click to download the PDB-style file with coordinates for d1tzzb2.
(The format of our PDB-style files is described here.)

Timeline for d1tzzb2:

Domains from same chain:
(mouse over for more information)
d1tzzb1
Domains from other chains:
(mouse over for more information)
d1tzza1, d1tzza2