SCOPe 2.04: Domain d1tyqa1: 1tyq A:2-160

Lineage for d1tyqa1 (1tyq A:2-160)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein Actin-related protein 3, Arp3 [69528] (1 species)
   part of Arp2/3 complex

7. Species Cow (Bos taurus) [TaxId:9913] [69529] (16 PDB entries)
   Uniprot P61158

8. Domain d1tyqa1: 1tyq A:2-160 [112841]
   Other proteins in same PDB: d1tyqb1, d1tyqc_, d1tyqd1, d1tyqd2, d1tyqe_, d1tyqf_, d1tyqg_
   complexed with atp, ca

Details for d1tyqa1

PDB Entry: 1tyq, 2.55 Å

PDB Description: Crystal structure of Arp2/3 complex with bound ATP and calcium

PDB Compounds: (A:) Actin-related protein 3

SCOPe Domain Sequences for d1tyqa1:

Sequence, based on SEQRES records:

>d1tyqa1 c.55.1.1 (A:2-160) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]}
agrlpacvvdcgtgytklgyagntepqfiipsciaikesakvgdqaqrrvmkgvddldff
igdeaiekptyatkwpirhgivedwdlmerfmeqvifkylraepedhyflltepplntpe
nreytaeimfesfnvpglyiavqavlalaaswtsrqvge

Sequence, based on observed residues (ATOM records):

>d1tyqa1 c.55.1.1 (A:2-160) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]}
agrlpacvvdcgtgytklgyagntepqfiipsciaikemkgvddldffigdeaiekptya
tkwpirhgivedwdlmerfmeqvifkylraepedhyflltepplntpenreytaeimfes
fnvpglyiavqavlalaaswtsrqvge

Timeline for d1tyqa1:

• d1tyqa1 first appeared in SCOP 1.71
  
• d1tyqa1 appears in SCOPe 2.03
  
• d1tyqa1 appears in SCOPe 2.05
  
• d1tyqa1 appears in the current release, SCOPe 2.08