Lineage for d1tyqa1 (1tyq A:2-160)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1857401Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1857402Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 1857617Protein Actin-related protein 3, Arp3 [69528] (1 species)
    part of Arp2/3 complex
  7. 1857618Species Cow (Bos taurus) [TaxId:9913] [69529] (16 PDB entries)
    Uniprot P61158
  8. 1857631Domain d1tyqa1: 1tyq A:2-160 [112841]
    Other proteins in same PDB: d1tyqb1, d1tyqc_, d1tyqd1, d1tyqd2, d1tyqe_, d1tyqf_, d1tyqg_
    complexed with atp, ca

Details for d1tyqa1

PDB Entry: 1tyq (more details), 2.55 Å

PDB Description: Crystal structure of Arp2/3 complex with bound ATP and calcium
PDB Compounds: (A:) Actin-related protein 3

SCOPe Domain Sequences for d1tyqa1:

Sequence, based on SEQRES records: (download)

>d1tyqa1 c.55.1.1 (A:2-160) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]}
agrlpacvvdcgtgytklgyagntepqfiipsciaikesakvgdqaqrrvmkgvddldff
igdeaiekptyatkwpirhgivedwdlmerfmeqvifkylraepedhyflltepplntpe
nreytaeimfesfnvpglyiavqavlalaaswtsrqvge

Sequence, based on observed residues (ATOM records): (download)

>d1tyqa1 c.55.1.1 (A:2-160) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]}
agrlpacvvdcgtgytklgyagntepqfiipsciaikemkgvddldffigdeaiekptya
tkwpirhgivedwdlmerfmeqvifkylraepedhyflltepplntpenreytaeimfes
fnvpglyiavqavlalaaswtsrqvge

SCOPe Domain Coordinates for d1tyqa1:

Click to download the PDB-style file with coordinates for d1tyqa1.
(The format of our PDB-style files is described here.)

Timeline for d1tyqa1: