Lineage for d1tyqe_ (1tyq E:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1506852Fold a.148: Arp2/3 complex 21 kDa subunit ARPC3 [69059] (1 superfamily)
    5 helices; one helix is surrounded by the others
  4. 1506853Superfamily a.148.1: Arp2/3 complex 21 kDa subunit ARPC3 [69060] (1 family) (S)
    automatically mapped to Pfam PF04062
  5. 1506854Family a.148.1.1: Arp2/3 complex 21 kDa subunit ARPC3 [69061] (2 proteins)
  6. 1506855Protein Arp2/3 complex 21 kDa subunit ARPC3 [69062] (1 species)
  7. 1506856Species Cow (Bos taurus) [TaxId:9913] [69063] (5 PDB entries)
    Uniprot O15145 # 100% sequence identity
  8. 1506861Domain d1tyqe_: 1tyq E: [112847]
    Other proteins in same PDB: d1tyqa1, d1tyqa2, d1tyqb1, d1tyqc_, d1tyqd1, d1tyqd2, d1tyqf_, d1tyqg_
    complexed with atp, ca

Details for d1tyqe_

PDB Entry: 1tyq (more details), 2.55 Å

PDB Description: Crystal structure of Arp2/3 complex with bound ATP and calcium
PDB Compounds: (E:) Arp2/3 complex 21kDa subunit

SCOPe Domain Sequences for d1tyqe_:

Sequence, based on SEQRES records: (download)

>d1tyqe_ a.148.1.1 (E:) Arp2/3 complex 21 kDa subunit ARPC3 {Cow (Bos taurus) [TaxId: 9913]}
payhsslmdpdtklignmallpirsqfkgpapretkdtdivdeaiyyfkanvffknyeik
neadrtliyitlyiseclkklqkcnsksqgekemytlgitnfpipgepgfplnaiyakpa
nkqedevmraylqqlrqetglrlcekvfdpqndkpskwwtcfvkrqfmnksls

Sequence, based on observed residues (ATOM records): (download)

>d1tyqe_ a.148.1.1 (E:) Arp2/3 complex 21 kDa subunit ARPC3 {Cow (Bos taurus) [TaxId: 9913]}
payhsslmdpdtklignmallpirsqfkgpapretkdtdivdeaiyyfkanvffknyeik
neadrtliyitlyiseclkklqkcnsksqgekemytlgitnfpipgepgfplnaiyakpa
nkqedevmraylqqlrqetglrlcekvfdkpskwwtcfvkrqfmnksls

SCOPe Domain Coordinates for d1tyqe_:

Click to download the PDB-style file with coordinates for d1tyqe_.
(The format of our PDB-style files is described here.)

Timeline for d1tyqe_: