Lineage for d1tyed2 (1tye D:107-354)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 588443Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 588444Superfamily c.62.1: vWA-like [53300] (4 families) (S)
  5. 588445Family c.62.1.1: Integrin A (or I) domain [53301] (10 proteins)
  6. 588492Protein Integrin beta A domain [69542] (1 species)
  7. 588493Species Human (Homo sapiens) [TaxId:9606] [69543] (10 PDB entries)
  8. 588498Domain d1tyed2: 1tye D:107-354 [112835]
    Other proteins in same PDB: d1tyea_, d1tyeb1, d1tyeb3, d1tyec_, d1tyed1, d1tyed3, d1tyee_, d1tyef1, d1tyef3

Details for d1tyed2

PDB Entry: 1tye (more details), 2.9 Å

PDB Description: structural basis for allostery in integrins and binding of ligand- mimetic therapeutics to the platelet receptor for fibrinogen

SCOP Domain Sequences for d1tyed2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tyed2 c.62.1.1 (D:107-354) Integrin beta A domain {Human (Homo sapiens)}
vedypvdiyylmdlsysmkddlwsiqnlgtklatqmrkltsnlrigfgafvdkpvspymy
isppealenpcydmkttclpmfgykhvltltdqvtrfneevkkqsvsrnrdapeggfdai
mqatvcdekigwrndashllvfttdakthialdgrlagivqpndgqchvgsdnhysastt
mdypslglmteklsqkninlifavtenvvnlyqnyselipgttvgvlsmdssnvlqlivd
aygkirsk

SCOP Domain Coordinates for d1tyed2:

Click to download the PDB-style file with coordinates for d1tyed2.
(The format of our PDB-style files is described here.)

Timeline for d1tyed2: