Lineage for d1tyec_ (1tye C:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 565655Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 565830Superfamily b.69.8: Integrin alpha N-terminal domain [69318] (1 family) (S)
  5. 565831Family b.69.8.1: Integrin alpha N-terminal domain [69319] (1 protein)
  6. 565832Protein Integrin alpha N-terminal domain [69320] (2 species)
  7. 565833Species Human (Homo sapiens), isoform IIb [TaxId:9606] [117285] (6 PDB entries)
  8. 565838Domain d1tyec_: 1tye C: [112833]
    Other proteins in same PDB: d1tyeb1, d1tyeb2, d1tyeb3, d1tyed1, d1tyed2, d1tyed3, d1tyef1, d1tyef2, d1tyef3

Details for d1tyec_

PDB Entry: 1tye (more details), 2.9 Å

PDB Description: Structural basis for allostery in integrins and binding of ligand-mimetic therapeutics to the platelet receptor for fibrinogen

SCOP Domain Sequences for d1tyec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tyec_ b.69.8.1 (C:) Integrin alpha N-terminal domain {Human (Homo sapiens), isoform IIb}
lnldpvqltfyagpngsqfgfsldfhkdshgrvaivvgaprtlgpsqeetggvflcpwra
eggqcpsllfdlrdetrnvgsqtlqtfkarqglgasvvswsdvivacapwqhwnvlekte
eaektpvgscflaqpesgrraeyspcrgntlsriyvendfswdkryceagfssvvtqage
lvlgapggyyflgllaqapvadifssyrpgillwhvssqslsfdssnpeyfdgywgysva
vgefdgdlntteyvvgaptwswtlgaveildsyyqrlhrlraeqmasyfghsvavtdvng
dgrhdllvgaplymesradrklaevgrvylflqprgphalgapsllltgtqlygrfgsai
aplgdldrdgyndiavaapyggpsgrgqvlvflgqseglrsrpsqvldspfptgsafgfs
lrgavdiddngypdlivgayganqvavyraqp

SCOP Domain Coordinates for d1tyec_:

Click to download the PDB-style file with coordinates for d1tyec_.
(The format of our PDB-style files is described here.)

Timeline for d1tyec_: