PDB entry 1tye

View 1tye on RCSB PDB site
Description: Structural basis for allostery in integrins and binding of ligand-mimetic therapeutics to the platelet receptor for fibrinogen
Deposited on 2004-07-07, released 2004-10-12
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-09, with a file datestamp of 2004-11-09.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.219
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tyeA (A:)
    lnldpvqltfyagpngsqfgfsldfhkdshgrvaivvgaprtlgpsqeetggvflcpwra
    eggqcpsllfdlrdetrnvgsqtlqtfkarqglgasvvswsdvivacapwqhwnvlekte
    eaektpvgscflaqpesgrraeyspcrgntlsriyvendfswdkryceagfssvvtqage
    lvlgapggyyflgllaqapvadifssyrpgillwhvssqslsfdssnpeyfdgywgysva
    vgefdgdlntteyvvgaptwswtlgaveildsyyqrlhrlraeqmasyfghsvavtdvng
    dgrhdllvgaplymesradrklaevgrvylflqprgphalgapsllltgtqlygrfgsai
    aplgdldrdgyndiavaapyggpsgrgqvlvflgqseglrsrpsqvldspfptgsafgfs
    lrgavdiddngypdlivgayganqvavyraqp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tyeB (B:)
    gpnicttrgvsscqqclavspmcawcsdealplgsprcdlkenllkdncapesiefpvse
    arvledrplsdkgsgdssqvtqvspqrialrlrpddsknfsiqvrqvedypvdiyylmdl
    sysmkddlwsiqnlgtklatqmrkltsnlrigfgafvdkpvspymyisppealenpcydm
    kttclpmfgykhvltltdqvtrfneevkkqsvsrnrdapeggfdaimqatvcdekigwrn
    dashllvfttdakthialdgrlagivqpndgqchvgsdnhysasttmdypslglmtekls
    qkninlifavtenvvnlyqnyselipgttvgvlsmdssnvlqlivdaygkirskvelevr
    dlpeelslsfnatclnnevipglkscmglkigdtvsfsieakvrgcpqekeksftikpvg
    fkdslivqvtfdcdcacqaq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tyeC (C:)
    lnldpvqltfyagpngsqfgfsldfhkdshgrvaivvgaprtlgpsqeetggvflcpwra
    eggqcpsllfdlrdetrnvgsqtlqtfkarqglgasvvswsdvivacapwqhwnvlekte
    eaektpvgscflaqpesgrraeyspcrgntlsriyvendfswdkryceagfssvvtqage
    lvlgapggyyflgllaqapvadifssyrpgillwhvssqslsfdssnpeyfdgywgysva
    vgefdgdlntteyvvgaptwswtlgaveildsyyqrlhrlraeqmasyfghsvavtdvng
    dgrhdllvgaplymesradrklaevgrvylflqprgphalgapsllltgtqlygrfgsai
    aplgdldrdgyndiavaapyggpsgrgqvlvflgqseglrsrpsqvldspfptgsafgfs
    lrgavdiddngypdlivgayganqvavyraqp
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tyeD (D:)
    gpnicttrgvsscqqclavspmcawcsdealplgsprcdlkenllkdncapesiefpvse
    arvledrplsdkgsgdssqvtqvspqrialrlrpddsknfsiqvrqvedypvdiyylmdl
    sysmkddlwsiqnlgtklatqmrkltsnlrigfgafvdkpvspymyisppealenpcydm
    kttclpmfgykhvltltdqvtrfneevkkqsvsrnrdapeggfdaimqatvcdekigwrn
    dashllvfttdakthialdgrlagivqpndgqchvgsdnhysasttmdypslglmtekls
    qkninlifavtenvvnlyqnyselipgttvgvlsmdssnvlqlivdaygkirskvelevr
    dlpeelslsfnatclnnevipglkscmglkigdtvsfsieakvrgcpqekeksftikpvg
    fkdslivqvtfdcdcacqaq
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tyeE (E:)
    lnldpvqltfyagpngsqfgfsldfhkdshgrvaivvgaprtlgpsqeetggvflcpwra
    eggqcpsllfdlrdetrnvgsqtlqtfkarqglgasvvswsdvivacapwqhwnvlekte
    eaektpvgscflaqpesgrraeyspcrgntlsriyvendfswdkryceagfssvvtqage
    lvlgapggyyflgllaqapvadifssyrpgillwhvssqslsfdssnpeyfdgywgysva
    vgefdgdlntteyvvgaptwswtlgaveildsyyqrlhrlraeqmasyfghsvavtdvng
    dgrhdllvgaplymesradrklaevgrvylflqprgphalgapsllltgtqlygrfgsai
    aplgdldrdgyndiavaapyggpsgrgqvlvflgqseglrsrpsqvldspfptgsafgfs
    lrgavdiddngypdlivgayganqvavyraqp
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tyeF (F:)
    gpnicttrgvsscqqclavspmcawcsdealplgsprcdlkenllkdncapesiefpvse
    arvledrplsdkgsgdssqvtqvspqrialrlrpddsknfsiqvrqvedypvdiyylmdl
    sysmkddlwsiqnlgtklatqmrkltsnlrigfgafvdkpvspymyisppealenpcydm
    kttclpmfgykhvltltdqvtrfneevkkqsvsrnrdapeggfdaimqatvcdekigwrn
    dashllvfttdakthialdgrlagivqpndgqchvgsdnhysasttmdypslglmtekls
    qkninlifavtenvvnlyqnyselipgttvgvlsmdssnvlqlivdaygkirskvelevr
    dlpeelslsfnatclnnevipglkscmglkigdtvsfsieakvrgcpqekeksftikpvg
    fkdslivqvtfdcdcacqaq