SCOP 1.71: Domain d1ty7l2: 1ty7 L:108-214

Lineage for d1ty7l2 (1ty7 L:108-214)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (284 PDB entries)

8. Domain d1ty7l2: 1ty7 L:108-214 [112825]
   Other proteins in same PDB: d1ty7a_, d1ty7b1, d1ty7b2, d1ty7b3, d1ty7h1, d1ty7h2, d1ty7l1
   complexed with 180, ca, gol, man, mg, nag

Details for d1ty7l2

PDB Entry: 1ty7, 3.1 Å

PDB Description: Structural basis for allostery in integrins and binding of ligand-mimetic therapeutics to the platelet receptor for fibrinogen

SCOP Domain Sequences for d1ty7l2:

Sequence; same for both SEQRES and ATOM records:

>d1ty7l2 b.1.1.2 (L:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d1ty7l2:

• d1ty7l2 is new in SCOP 1.71
  
• d1ty7l2 last appears in SCOP 1.73