Lineage for d1ty7a_ (1ty7 A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 565655Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 565830Superfamily b.69.8: Integrin alpha N-terminal domain [69318] (1 family) (S)
  5. 565831Family b.69.8.1: Integrin alpha N-terminal domain [69319] (1 protein)
  6. 565832Protein Integrin alpha N-terminal domain [69320] (2 species)
  7. 565833Species Human (Homo sapiens), isoform IIb [TaxId:9606] [117285] (6 PDB entries)
  8. 565841Domain d1ty7a_: 1ty7 A: [112818]
    Other proteins in same PDB: d1ty7b1, d1ty7b2, d1ty7b3, d1ty7h1, d1ty7h2, d1ty7l1, d1ty7l2
    complexed with 180, ca, gol, man, mg, nag

Details for d1ty7a_

PDB Entry: 1ty7 (more details), 3.1 Å

PDB Description: Structural basis for allostery in integrins and binding of ligand-mimetic therapeutics to the platelet receptor for fibrinogen

SCOP Domain Sequences for d1ty7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ty7a_ b.69.8.1 (A:) Integrin alpha N-terminal domain {Human (Homo sapiens), isoform IIb}
lnldpvqltfyagpngsqfgfsldfhkdshgrvaivvgaprtlgpsqeetggvflcpwra
eggqcpsllfdlrdetrnvgsqtlqtfkarqglgasvvswsdvivacapwqhwnvlekte
eaektpvgscflaqpesgrraeyspcrgntlsriyvendfswdkryceagfssvvtqage
lvlgapggyyflgllaqapvadifssyrpgillwhvssqslsfdssnpeyfdgywgysva
vgefdgdlntteyvvgaptwswtlgaveildsyyqrlhrlraeqmasyfghsvavtdvng
dgrhdllvgaplymesradrklaevgrvylflqprgphalgapsllltgtqlygrfgsai
aplgdldrdgyndiavaapyggpsgrgqvlvflgqseglrsrpsqvldspfptgsafgfs
lrgavdiddngypdlivgayganqvavyraqp

SCOP Domain Coordinates for d1ty7a_:

Click to download the PDB-style file with coordinates for d1ty7a_.
(The format of our PDB-style files is described here.)

Timeline for d1ty7a_: