![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
![]() | Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88576] (302 PDB entries) |
![]() | Domain d1ty7h2: 1ty7 H:120-219 [112823] Other proteins in same PDB: d1ty7a_, d1ty7b1, d1ty7b2, d1ty7b3, d1ty7h1, d1ty7l1, d1ty7l2 complexed with 180, ca, gol, man, mg, nag |
PDB Entry: 1ty7 (more details), 3.1 Å
SCOP Domain Sequences for d1ty7h2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ty7h2 b.1.1.2 (H:120-219) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)} akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd lytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr
Timeline for d1ty7h2: