Lineage for d1ty7b3 (1ty7 B:1-57)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 623301Fold g.16: Trefoil/Plexin domain-like [57491] (3 superfamilies)
    disulfide-rich fold; common core is alpha+beta with two conserved disulfides
  4. 623330Superfamily g.16.2: Plexin repeat [103575] (1 family) (S)
  5. 623331Family g.16.2.1: Plexin repeat [103576] (3 proteins)
    Pfam 01437
  6. 623336Protein Integrin beta-3 [118249] (1 species)
  7. 623337Species Human (Homo sapiens) [TaxId:9606] [118250] (7 PDB entries)
  8. 623345Domain d1ty7b3: 1ty7 B:1-57 [112821]
    Other proteins in same PDB: d1ty7a_, d1ty7b1, d1ty7b2, d1ty7h1, d1ty7h2, d1ty7l1, d1ty7l2
    complexed with 180, ca, gol, man, mg, nag

Details for d1ty7b3

PDB Entry: 1ty7 (more details), 3.1 Å

PDB Description: Structural basis for allostery in integrins and binding of ligand-mimetic therapeutics to the platelet receptor for fibrinogen

SCOP Domain Sequences for d1ty7b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ty7b3 g.16.2.1 (B:1-57) Integrin beta-3 {Human (Homo sapiens)}
gpnicttrgvsscqqclavspmcawcsdealplgsprcdlkenllkdncapesiefp

SCOP Domain Coordinates for d1ty7b3:

Click to download the PDB-style file with coordinates for d1ty7b3.
(The format of our PDB-style files is described here.)

Timeline for d1ty7b3: