Class a: All alpha proteins [46456] (284 folds) |
Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily) core: 2 helices and adjacent loops |
Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits |
Family a.143.1.2: RPB6 [55294] (1 protein) |
Protein RPB6 [55295] (2 species) essential subunit of RNA polymerases I, II and III |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64318] (29 PDB entries) Uniprot P20435; part of multichain biological unit |
Domain d1twaf_: 1twa F: [112702] Other proteins in same PDB: d1twaa_, d1twab_, d1twac1, d1twac2, d1twae1, d1twae2, d1twah_, d1twai1, d1twai2, d1twaj_, d1twak_, d1twal_ protein/RNA complex; complexed with atp, mn, zn |
PDB Entry: 1twa (more details), 3.2 Å
SCOPe Domain Sequences for d1twaf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1twaf_ a.143.1.2 (F:) RPB6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} kaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplriamkelaekkip lvirrylpdgsfedwsveelivd
Timeline for d1twaf_: