Lineage for d1twaf_ (1twa F:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2734750Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
    core: 2 helices and adjacent loops
  4. 2734751Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) (S)
    the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits
  5. 2734802Family a.143.1.2: RPB6 [55294] (2 proteins)
  6. 2734803Protein RPB6 [55295] (3 species)
    essential subunit of RNA polymerases I, II and III
  7. 2734804Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64318] (31 PDB entries)
    Uniprot P20435; part of multichain biological unit
  8. 2734810Domain d1twaf_: 1twa F: [112702]
    Other proteins in same PDB: d1twaa_, d1twab_, d1twac1, d1twac2, d1twae1, d1twae2, d1twah_, d1twai1, d1twai2, d1twaj_, d1twak_, d1twal_
    protein/RNA complex; complexed with atp, mn, zn

Details for d1twaf_

PDB Entry: 1twa (more details), 3.2 Å

PDB Description: RNA polymerase II complexed with ATP
PDB Compounds: (F:) DNA-directed RNA polymerases I, II, and III 23 kDa polypeptide

SCOPe Domain Sequences for d1twaf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1twaf_ a.143.1.2 (F:) RPB6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplriamkelaekkip
lvirrylpdgsfedwsveelivd

SCOPe Domain Coordinates for d1twaf_:

Click to download the PDB-style file with coordinates for d1twaf_.
(The format of our PDB-style files is described here.)

Timeline for d1twaf_: