Lineage for d1twab_ (1twa B:)

  1. Root: SCOPe 2.01
  2. 1054197Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1057387Fold e.29: beta and beta-prime subunits of DNA dependent RNA-polymerase [64483] (1 superfamily)
    Multidomain subunits of complex domain organization
  4. 1057388Superfamily e.29.1: beta and beta-prime subunits of DNA dependent RNA-polymerase [64484] (2 families) (S)
    The catalytic site is formed by the association of two double-psi beta-barrel domains, one from each subunit
  5. 1057389Family e.29.1.1: RNA-polymerase beta [64485] (3 proteins)
  6. 1057390Protein RBP2 [64491] (1 species)
  7. 1057391Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64492] (27 PDB entries)
    Uniprot P08518; part of multichain biological unit
  8. 1057397Domain d1twab_: 1twa B: [112697]
    Other proteins in same PDB: d1twaa_, d1twac1, d1twac2, d1twae1, d1twae2, d1twaf_, d1twah_, d1twai1, d1twai2, d1twaj_, d1twak_, d1twal_
    protein/RNA complex; complexed with atp, mn, zn

Details for d1twab_

PDB Entry: 1twa (more details), 3.2 Å

PDB Description: RNA polymerase II complexed with ATP
PDB Compounds: (B:) DNA-directed RNA polymerase II 140 kDa polypeptide

SCOPe Domain Sequences for d1twab_:

Sequence, based on SEQRES records: (download)

>d1twab_ e.29.1.1 (B:) RBP2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
fedesapitaedswavisaffrekglvsqqldsfnqfvdytlqdiicedstlileqlaqh
ttesdnisrkyeisfgkiyvtkpmvnesdgvthalypqearlrnltyssglfvdvkkrty
eaidvpgrelkyeliaeeseddsesgkvfigrlpimlrskncylseatesdlyklkecpf
dmggyfiingsekvliaqersagnivqvfkkaapspishvaeirsalekgsrfistlqvk
lygregssartikatlpyikqdipiviifralgiipdgeilehicydvndwqmlemlkpc
vedgfviqdretaldfigrrgtalgikkekriqyakdilqkeflphitqlegfesrkaff
lgyminrlllcaldrkdqddrdhfgkkrldlagpllaqlfktlfkkltkdifrymqrtve
eahdfnmklainaktitsglkyalatgnwgeqkkamssragvsqvlnrytysstlshlrr
tntpigrdgklakprqlhnthwglvcpaetpegqacglvknlslmscisvgtdpmpiitf
lsewgmepledyvphqspdatrvfvngvwhgvhrnparlmetlrtlrrkgdinpevsmir
direkelkiftdagrvyrplfiveddeslghkelkvrkghiaklmateyqdieggfedve
eytwssllneglveyidaeeeesiliamqpedlepaeaneendldvdpakrirvshhatt
fthceihpsmilgvaasiipfpdhnqsprntyqsamgkqamgvfltnynvrmdtmanily
ypqkplgttrameylkfrelpagqnaivaiacysgynqedsmimnqssidrglfrslffr
symdqekkygmsitetfekpqrtntlrmkhgtydkldddgliapgvrvsgedviigkttp
ispdeeelgqrtayhskrdastplrstengivdqvlvttnqdglkfvkvrvrttkipqig
dkfasrhgqkgtigityrredmpftaegivpdliinphaipsrmtvahliecllskvaal
sgnegdaspftditvegiskllrehgyqsrgfevmynghtgkklmaqiffgptyyqrlrh
mvddkiharargpmqvltrqpvegrsrdgglrfgemerdcmiahgaasflkerlmeasda
frvhicgicglmtviaklnhnqfeckgcdnkidiyqihipyaakllfqelmamnitprly
tdrsrdf

Sequence, based on observed residues (ATOM records): (download)

>d1twab_ e.29.1.1 (B:) RBP2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
fedesapitaedswavisaffrekglvsqqldsfnqfvdytlqdiicedstlieisfgki
yvtkpmvnesdgvthalypqearlrnltyssglfvdvkkrtyekvfigrlpimlrskncy
lseatesdlyklkecpfdmggyfiingsekvliaqersagnivqvfkkaapspishvaei
rsalekgsrfistlqvklygregssartikatlpyikqdipiviifralgiipdgeileh
icydvndwqmlemlkpcvedgfviqdretaldfigrrgtalgikkekriqyakdilqkef
lphitqlegfesrkafflgyminrlllcaldrkdqddrdhfgkkrldlagpllaqlfktl
fkkltkdifrymqrtvelainaktitsglkyalatgnwgagvsqvlnrytysstlshlrr
tntpiakprqlhnthwglvcpaetpegqacglvknlslmscisvgtdpmpiitflsewgm
epledyvphqspdatrvfvngvwhgvhrnparlmetlrtlrrkgdinpevsmirdireke
lkiftdagrvyrplfiveddeslghkelkvrkghiaklmateyqdeytwssllneglvey
idaeeeesiliamqpedlepdvdpakrirvshhattfthceihpsmilgvaasiipfpdh
nqsprntyqsamgkqamgvfltnynvrmdtmanilyypqkplgttrameylkfrelpagq
naivaiacysgynqedsmimnqssidrglfrslffrsymdqekkygmsitetfekpqrtn
tlrmkhgtydkldddgliapgvrvsgedviigkttskrdastplrstengivdqvlvttn
qdglkfvkvrvrttkipqigdkfasrhgqkgtigityrredmpftaegivpdliinphai
psrmtvahliecllskvaalsgnegdaspftditvegiskllrehgyqsrgfevmynght
gkklmaqiffgptyyqrlrhmvddkiharargpglrfgemerdcmiahgaasflkerlme
asdafrvhicgicglmtviaklnhnqfeckgcdnkidiyqihipyaakllfqelmamnit
prlytdrsrdf

SCOPe Domain Coordinates for d1twab_:

Click to download the PDB-style file with coordinates for d1twab_.
(The format of our PDB-style files is described here.)

Timeline for d1twab_: