Lineage for d1tu8b2 (1tu8 B:1-77)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1168056Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1168057Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1168419Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)
  6. 1168697Protein Class pi GST [81358] (4 species)
  7. 1168817Species Onchocerca volvulus [TaxId:6282] [117595] (2 PDB entries)
    Uniprot P46427
  8. 1168821Domain d1tu8b2: 1tu8 B:1-77 [112660]
    Other proteins in same PDB: d1tu8a1, d1tu8b1, d1tu8c1, d1tu8d1
    complexed with gtx

Details for d1tu8b2

PDB Entry: 1tu8 (more details), 1.8 Å

PDB Description: structure of onchoverca volvulus pi-class glutathione s-transferase with its kompetitive inhibitor s-hexyl-gsh
PDB Compounds: (B:) Glutathione S-transferase 2

SCOPe Domain Sequences for d1tu8b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tu8b2 c.47.1.5 (B:1-77) Class pi GST {Onchocerca volvulus [TaxId: 6282]}
msykltyfsirglaepirlflvdqdikfiddriakddfssiksqfqfgqlpclydgdqqi
vqsgailrhlarkynln

SCOPe Domain Coordinates for d1tu8b2:

Click to download the PDB-style file with coordinates for d1tu8b2.
(The format of our PDB-style files is described here.)

Timeline for d1tu8b2: