Lineage for d1tu8c1 (1tu8 C:78-208)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1089232Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1089233Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1089234Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)
  6. 1089512Protein Class pi GST [81347] (4 species)
  7. 1089632Species Onchocerca volvulus [TaxId:6282] [116911] (2 PDB entries)
    Uniprot P46427
  8. 1089637Domain d1tu8c1: 1tu8 C:78-208 [112661]
    Other proteins in same PDB: d1tu8a2, d1tu8b2, d1tu8c2, d1tu8d2
    complexed with gtx

Details for d1tu8c1

PDB Entry: 1tu8 (more details), 1.8 Å

PDB Description: structure of onchoverca volvulus pi-class glutathione s-transferase with its kompetitive inhibitor s-hexyl-gsh
PDB Compounds: (C:) Glutathione S-transferase 2

SCOPe Domain Sequences for d1tu8c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tu8c1 a.45.1.1 (C:78-208) Class pi GST {Onchocerca volvulus [TaxId: 6282]}
genemettyidmfcegvrdlhvkytrmiymayetekdpyiksilpgelakfekllatrgn
grnlilgdkisyadyalfeeldvhqildphcldkfpllkvfhqrmkdrpklkeycekrda
akvpvngngkq

SCOPe Domain Coordinates for d1tu8c1:

Click to download the PDB-style file with coordinates for d1tu8c1.
(The format of our PDB-style files is described here.)

Timeline for d1tu8c1: