SCOPe 2.08: Domain d1tkta1: 1tkt A:430-537

Lineage for d1tkta1 (1tkt A:430-537)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (5 proteins)

6. Protein HIV RNase H (Domain of reverse transcriptase) [53105] (3 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (104 PDB entries)
   Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582 ! Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584 ! Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595

8. Domain d1tkta1: 1tkt A:430-537 [112482]
   Other proteins in same PDB: d1tkta2, d1tktb1
   complexed with h12, mg, po4

Details for d1tkta1

PDB Entry: 1tkt, 2.6 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase in complex with gw426318

PDB Compounds: (A:) Pol polyproteins [Reverse transcriptase], Chain A

SCOPe Domain Sequences for d1tkta1:

Sequence, based on SEQRES records:

>d1tkta1 c.55.3.1 (A:430-537) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1 [TaxId: 11676]}
ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvp

Sequence, based on observed residues (ATOM records):

>d1tkta1 c.55.3.1 (A:430-537) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1 [TaxId: 11676]}
ekepivgaetfyvdagyvtnrgrqkvvtltdttnqktelqaiylalqdsglevnivtdsq
yalgiiqaqpdqseselvnqiieqlikkekvylawvp

Timeline for d1tkta1:

• d1tkta1 first appeared in SCOP 1.71
  
• d1tkta1 appears in SCOPe 2.07