SCOPe 2.01: Domain d1t9ha1: 1t9h A:1-67

Lineage for d1t9ha1 (1t9h A:1-67)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
   barrel, closed; n=5, S=8

6. Protein Probable GTPase EngC (YjeQ), N-terminal domain [110200] (2 species)

7. Species Bacillus subtilis [TaxId:1423] [117197] (1 PDB entry)
   Uniprot O34530

8. Domain d1t9ha1: 1t9h A:1-67 [112358]
   Other proteins in same PDB: d1t9ha2
   complexed with act, ca, ium, zn

Details for d1t9ha1

PDB Entry: 1t9h, 1.6 Å

PDB Description: The crystal structure of YloQ, a circularly permuted GTPase.

PDB Compounds: (A:) Probable GTPase engC

SCOPe Domain Sequences for d1t9ha1:

Sequence; same for both SEQRES and ATOM records:

>d1t9ha1 b.40.4.5 (A:1-67) Probable GTPase EngC (YjeQ), N-terminal domain {Bacillus subtilis [TaxId: 1423]}
mpegkiikalsgfyyvldesedsdkviqcrgrgifrknkitplvgdyvvyqaendkegyl
meikert

Timeline for d1t9ha1:

• d1t9ha1 first appeared in SCOP 1.71
  
• d1t9ha1 appears in SCOP 1.75
  
• d1t9ha1 appears in SCOPe 2.02
  
• d1t9ha1 appears in the current release, SCOPe 2.08