Lineage for d1t9ha1 (1t9h A:1-67)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2789672Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins)
    barrel, closed; n=5, S=8
  6. 2789898Protein Probable GTPase EngC (YjeQ), N-terminal domain [110200] (2 species)
  7. 2789899Species Bacillus subtilis [TaxId:1423] [117197] (1 PDB entry)
    Uniprot O34530
  8. 2789900Domain d1t9ha1: 1t9h A:1-67 [112358]
    Other proteins in same PDB: d1t9ha2, d1t9ha3
    complexed with act, ca, ium, zn

Details for d1t9ha1

PDB Entry: 1t9h (more details), 1.6 Å

PDB Description: The crystal structure of YloQ, a circularly permuted GTPase.
PDB Compounds: (A:) Probable GTPase engC

SCOPe Domain Sequences for d1t9ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t9ha1 b.40.4.5 (A:1-67) Probable GTPase EngC (YjeQ), N-terminal domain {Bacillus subtilis [TaxId: 1423]}
mpegkiikalsgfyyvldesedsdkviqcrgrgifrknkitplvgdyvvyqaendkegyl
meikert

SCOPe Domain Coordinates for d1t9ha1:

Click to download the PDB-style file with coordinates for d1t9ha1.
(The format of our PDB-style files is described here.)

Timeline for d1t9ha1: