![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) ![]() |
![]() | Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (32 proteins) barrel, closed; n=5, S=8 |
![]() | Protein Probable GTPase EngC (YjeQ), N-terminal domain [110200] (2 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [117197] (1 PDB entry) Uniprot O34530 |
![]() | Domain d1t9ha1: 1t9h A:1-67 [112358] Other proteins in same PDB: d1t9ha2, d1t9ha3 complexed with act, ca, ium, zn |
PDB Entry: 1t9h (more details), 1.6 Å
SCOPe Domain Sequences for d1t9ha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t9ha1 b.40.4.5 (A:1-67) Probable GTPase EngC (YjeQ), N-terminal domain {Bacillus subtilis [TaxId: 1423]} mpegkiikalsgfyyvldesedsdkviqcrgrgifrknkitplvgdyvvyqaendkegyl meikert
Timeline for d1t9ha1: