SCOPe 2.01: Domain d1t9ha2: 1t9h A:68-298

Lineage for d1t9ha2 (1t9h A:68-298)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Probable GTPase EngC (YjeQ), C-terminal domain [110542] (2 species)
   circularly permuted G-domain similar to B. sutilis YlqF; distinct extra C-terminal all-alpha subdomain

7. Species Bacillus subtilis [TaxId:1423] [117534] (1 PDB entry)
   Uniprot O34530

8. Domain d1t9ha2: 1t9h A:68-298 [112359]
   Other proteins in same PDB: d1t9ha1
   complexed with act, ca, ium, zn

Details for d1t9ha2

PDB Entry: 1t9h, 1.6 Å

PDB Description: The crystal structure of YloQ, a circularly permuted GTPase.

PDB Compounds: (A:) Probable GTPase engC

SCOPe Domain Sequences for d1t9ha2:

Sequence, based on SEQRES records:

>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]}
nelirppicnvdqavlvfsavqpsfstalldrflvlveandiqpiicitkmdliedqdte
dtiqayaedyrnigydvyltsskdqdsladiiphfqdkttvfagqsgvgkssllnaispe
lglrtneisehlgrgkhttrhvelihtsgglvadtpgfssleftdieeeelgytfpdire
ksssckfrgclhlkepkcavkqavedgelkqyrydhyvefmteikdrkpry

Sequence, based on observed residues (ATOM records):

>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]}
nelirppicnvdqavlvfsavqpsfstalldrflvlveandiqpiicitkmdliedqdte
dtiqayaedyrnigydvyltsskdqdsladiiphfqdkttvfagqsgvgkssllnaispt
rhvelihtsgglvadtpgfssleftdieeeelgytfpdireksssckfrgclhlkepkca
vkqavedgelkqyrydhyvefmteikdrkpry

Timeline for d1t9ha2:

• d1t9ha2 first appeared in SCOP 1.71
  
• d1t9ha2 appears in SCOP 1.75
  
• d1t9ha2 appears in SCOPe 2.02
  
• d1t9ha2 appears in the current release, SCOPe 2.08