Class a: All alpha proteins [46456] (290 folds) |
Fold a.169: BEACH domain [81836] (1 superfamily) multihelical, complex architecture |
Superfamily a.169.1: BEACH domain [81837] (1 family) automatically mapped to Pfam PF02138 |
Family a.169.1.1: BEACH domain [81838] (2 proteins) Pfam PF02138 |
Protein Lipopolysaccharide-responsive and beige-like anchor protein LRBA [116981] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [116982] (1 PDB entry) Uniprot P50851 2076-2489 |
Domain d1t77d1: 1t77 D:2186-2489 [112296] Other proteins in same PDB: d1t77a2, d1t77b2, d1t77c2, d1t77d2 |
PDB Entry: 1t77 (more details), 2.4 Å
SCOPe Domain Sequences for d1t77d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t77d1 a.169.1.1 (D:2186-2489) Lipopolysaccharide-responsive and beige-like anchor protein LRBA {Human (Homo sapiens) [TaxId: 9606]} gtsfglpqtrrislasprqlfkasnmtqrwqhreisnfeylmflntiagrsyndlnqypv fpwvitnyeseeldltlptnfrdlskpigalnpkraaffaeryesweddqvpkfhygthy stasfvlawllriepfttyflnlqggkfdhadrtfssisrawrnsqrdtsdikelipefy ylpemfvnfnnynlgvmddgtvvsdvelppwaktseefvhinrlalesefvscqlhqwid lifgykqqgpeavralnvfyyltyegavnlnsitdpvlreaveaqirsfgqtpsqlliep hppr
Timeline for d1t77d1: