Lineage for d1t77b1 (1t77 B:2186-2489)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735799Fold a.169: BEACH domain [81836] (1 superfamily)
    multihelical, complex architecture
  4. 2735800Superfamily a.169.1: BEACH domain [81837] (1 family) (S)
    automatically mapped to Pfam PF02138
  5. 2735801Family a.169.1.1: BEACH domain [81838] (2 proteins)
    Pfam PF02138
  6. 2735806Protein Lipopolysaccharide-responsive and beige-like anchor protein LRBA [116981] (1 species)
  7. 2735807Species Human (Homo sapiens) [TaxId:9606] [116982] (1 PDB entry)
    Uniprot P50851 2076-2489
  8. 2735809Domain d1t77b1: 1t77 B:2186-2489 [112292]
    Other proteins in same PDB: d1t77a2, d1t77b2, d1t77c2, d1t77d2

Details for d1t77b1

PDB Entry: 1t77 (more details), 2.4 Å

PDB Description: Crystal structure of the PH-BEACH domains of human LRBA/BGL
PDB Compounds: (B:) Lipopolysaccharide-responsive and beige-like anchor protein

SCOPe Domain Sequences for d1t77b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t77b1 a.169.1.1 (B:2186-2489) Lipopolysaccharide-responsive and beige-like anchor protein LRBA {Human (Homo sapiens) [TaxId: 9606]}
gtsfglpqtrrislasprqlfkasnmtqrwqhreisnfeylmflntiagrsyndlnqypv
fpwvitnyeseeldltlptnfrdlskpigalnpkraaffaeryesweddqvpkfhygthy
stasfvlawllriepfttyflnlqggkfdhadrtfssisrawrnsqrdtsdikelipefy
ylpemfvnfnnynlgvmddgtvvsdvelppwaktseefvhinrlalesefvscqlhqwid
lifgykqqgpeavralnvfyyltyegavnlnsitdpvlreaveaqirsfgqtpsqlliep
hppr

SCOPe Domain Coordinates for d1t77b1:

Click to download the PDB-style file with coordinates for d1t77b1.
(The format of our PDB-style files is described here.)

Timeline for d1t77b1: