![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.55: PH domain-like barrel [50728] (3 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
![]() | Superfamily b.55.1: PH domain-like [50729] (14 families) ![]() |
![]() | Family b.55.1.6: PreBEACH PH-like domain [82146] (2 proteins) |
![]() | Protein Lipopolysaccharide-responsive and beige-like anchor protein LRBA [117263] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [117264] (1 PDB entry) Uniprot P50851 2076-2489 |
![]() | Domain d1t77a2: 1t77 A:2076-2185 [112291] Other proteins in same PDB: d1t77a1, d1t77b1, d1t77c1, d1t77d1 |
PDB Entry: 1t77 (more details), 2.4 Å
SCOPe Domain Sequences for d1t77a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t77a2 b.55.1.6 (A:2076-2185) Lipopolysaccharide-responsive and beige-like anchor protein LRBA {Human (Homo sapiens) [TaxId: 9606]} gpvslstpaqlvapsvvvkgtlsvtsselyfevdeedpnfkkidpkilayteglhgkwlf teirsifsrryllqntaleifmanrvavmfnfpdpatvkkvvnflprvgv
Timeline for d1t77a2: