Lineage for d1rg6a_ (1rg6 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2715428Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) (S)
  5. 2715476Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (16 proteins)
  6. 2715477Protein C-terminal domain of p63 [116934] (1 species)
  7. 2715478Species Human (Homo sapiens) [TaxId:9606] [116935] (1 PDB entry)
    Uniprot Q9H3D4 544-610
  8. 2715479Domain d1rg6a_: 1rg6 A: [111800]

Details for d1rg6a_

PDB Entry: 1rg6 (more details)

PDB Description: solution structure of the c-terminal domain of p63
PDB Compounds: (A:) second splice variant p63

SCOPe Domain Sequences for d1rg6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rg6a_ a.60.1.2 (A:) C-terminal domain of p63 {Human (Homo sapiens) [TaxId: 9606]}
ptdcsivsflarlgcsscldyfttqglttiyqiehysmddlaslkipeqfrhaiwkgild
hrqlhef

SCOPe Domain Coordinates for d1rg6a_:

Click to download the PDB-style file with coordinates for d1rg6a_.
(The format of our PDB-style files is described here.)

Timeline for d1rg6a_: