| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.95: Homing endonuclease-like [55603] (2 superfamilies) alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243 |
Superfamily d.95.2: Homing endonucleases [55608] (3 families) ![]() |
| Family d.95.2.1: Group I mobile intron endonuclease [55609] (6 proteins) contains two extra helices in the C-terminal extension |
| Protein DNA endonuclease I-SceI [118055] (1 species) duplication: contains tandem repeat of this fold |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [118056] (1 PDB entry) Uniprot P03882 |
| Domain d1r7mb1: 1r7m B:303-420 [111715] protein/DNA complex; complexed with ca |
PDB Entry: 1r7m (more details), 2.25 Å
SCOPe Domain Sequences for d1r7mb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r7mb1 d.95.2.1 (B:303-420) DNA endonuclease I-SceI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nikknqvmnlgpnskllkeyksqlielnieqfeagiglilgdayirsrdegktycmqfew
knkaymdhvcllydqwvlspphkkervnhlgnlvitwgaqtfkhqafnklanlfivnn
Timeline for d1r7mb1: