PDB entry 1r7m

View 1r7m on RCSB PDB site
Description: The homing endonuclease I-SceI bound to its DNA recognition region
Class: hydrolase/DNA
Keywords: protein-DNA complex, endonuclease, LAGLIDADG, BETA-SADDLE, HYDROLASE/DNA COMPLEX
Deposited on 2003-10-21, released 2004-10-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.235
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Intron-encoded endonuclease I-SceI
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SECY
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1r7ma1, d1r7ma2
  • Chain 'B':
    Compound: Intron-encoded endonuclease I-SceI
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SECY
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1r7mb1, d1r7mb2
  • Chain 'C':
    Compound: 5'-d(*cp*ap*cp*gp*cp*tp*ap*gp*gp*gp*ap*tp*ap*ap*cp*ap*gp*gp*gp*tp*ap*ap*tp*ap*c)-3'
  • Chain 'D':
    Compound: 5'-d(*gp*gp*tp*ap*tp*tp*ap*cp*cp*cp*tp*gp*tp*tp*ap*tp*cp*cp*cp*tp*ap*gp*cp*gp*t)-3'
  • Chain 'E':
    Compound: 5'-d(*cp*ap*cp*gp*cp*tp*ap*gp*gp*gp*ap*tp*ap*ap*cp*ap*gp*gp*gp*tp*ap*ap*tp*ap*c)-3'
  • Chain 'F':
    Compound: 5'-d(*gp*gp*tp*ap*tp*tp*ap*cp*cp*cp*tp*gp*tp*tp*ap*tp*cp*cp*cp*tp*ap*gp*cp*gp*t)-3'
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r7mA (A:)
    mknikknqvmnlgpnskllkeyksqlielnieqfeagiglilgdayirsrdegktycmqf
    ewknkaymdhvcllydqwvlspphkkervnhlgnlvitwgaqtfkhqafnklanlfivnn
    kktipnnlvenyltpmslaywfmddggkwdynknstnksivlntqsftfeeveylvkglr
    nkfqlncyvkinknkpiiyidsmsylifynlikpylipqmmyklpntissetflk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r7mA (A:)
    nikknqvmnlgpnskllkeyksqlielnieqfeagiglilgdayirsrdegktycmqfew
    knkaymdhvcllydqwvlspphkkervnhlgnlvitwgaqtfkhqafnklanlfivnnkk
    tipnnlvenyltpmslaywfmddggkwdynknstnksivlntqsftfeeveylvkglrnk
    fqlncyvkinknkpiiyidsmsylifynlikpylipqmmyklp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r7mB (B:)
    mknikknqvmnlgpnskllkeyksqlielnieqfeagiglilgdayirsrdegktycmqf
    ewknkaymdhvcllydqwvlspphkkervnhlgnlvitwgaqtfkhqafnklanlfivnn
    kktipnnlvenyltpmslaywfmddggkwdynknstnksivlntqsftfeeveylvkglr
    nkfqlncyvkinknkpiiyidsmsylifynlikpylipqmmyklpntissetflk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r7mB (B:)
    nikknqvmnlgpnskllkeyksqlielnieqfeagiglilgdayirsrdegktycmqfew
    knkaymdhvcllydqwvlspphkkervnhlgnlvitwgaqtfkhqafnklanlfivnnkk
    tipnnlvenyltpmslaywfmddggkwdynknstnksivlntqsftfeeveylvkglrnk
    fqlncyvkinknkpiiyidsmsylifynlikpylipqmmyklp
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.