SCOPe 2.08: Domain d1r7ma2: 1r7m A:121-225

Lineage for d1r7ma2 (1r7m A:121-225)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.95: Homing endonuclease-like [55603] (2 superfamilies)
   alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243

4. Superfamily d.95.2: Homing endonucleases [55608] (3 families)

5. Family d.95.2.1: Group I mobile intron endonuclease [55609] (6 proteins)
   contains two extra helices in the C-terminal extension

6. Protein DNA endonuclease I-SceI [118055] (1 species)
   duplication: contains tandem repeat of this fold

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [118056] (1 PDB entry)
   Uniprot P03882

8. Domain d1r7ma2: 1r7m A:121-225 [111714]
   protein/DNA complex; complexed with ca

Details for d1r7ma2

PDB Entry: 1r7m, 2.25 Å

PDB Description: The homing endonuclease I-SceI bound to its DNA recognition region

PDB Compounds: (A:) Intron-encoded endonuclease I-SceI

SCOPe Domain Sequences for d1r7ma2:

Sequence; same for both SEQRES and ATOM records:

>d1r7ma2 d.95.2.1 (A:121-225) DNA endonuclease I-SceI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kktipnnlvenyltpmslaywfmddggkwdynknstnksivlntqsftfeeveylvkglr
nkfqlncyvkinknkpiiyidsmsylifynlikpylipqmmyklp

Timeline for d1r7ma2:

• d1r7ma2 first appeared in SCOP 1.71
  
• d1r7ma2 appears in SCOPe 2.07