![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.95: Homing endonuclease-like [55603] (2 superfamilies) alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243 |
![]() | Superfamily d.95.2: Homing endonucleases [55608] (3 families) ![]() |
![]() | Family d.95.2.1: Group I mobile intron endonuclease [55609] (6 proteins) contains two extra helices in the C-terminal extension |
![]() | Protein DNA endonuclease I-SceI [118055] (1 species) duplication: contains tandem repeat of this fold |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [118056] (1 PDB entry) Uniprot P03882 |
![]() | Domain d1r7ma1: 1r7m A:3-120 [111713] protein/DNA complex; complexed with ca |
PDB Entry: 1r7m (more details), 2.25 Å
SCOPe Domain Sequences for d1r7ma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r7ma1 d.95.2.1 (A:3-120) DNA endonuclease I-SceI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} nikknqvmnlgpnskllkeyksqlielnieqfeagiglilgdayirsrdegktycmqfew knkaymdhvcllydqwvlspphkkervnhlgnlvitwgaqtfkhqafnklanlfivnn
Timeline for d1r7ma1: