SCOPe 2.08: Domain d1h47e1: 1h47 E:1-156

Lineage for d1h47e1 (1h47 E:1-156)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.5: IpsF-like [69765] (2 families)
   forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)

5. Family d.79.5.1: IpsF-like [69766] (3 proteins)
   automatically mapped to Pfam PF02542

6. Protein 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69767] (6 species)

7. Species Escherichia coli [TaxId:562] [69768] (14 PDB entries)
   Uniprot P62617 ! Uniprot P36663

8. Domain d1h47e1: 1h47 E:1-156 [111619]
   Other proteins in same PDB: d1h47a2, d1h47b2, d1h47c2, d1h47d2, d1h47e2, d1h47f2
   complexed with c5p, gpp, zn

Details for d1h47e1

PDB Entry: 1h47, 2 Å

PDB Description: structures of mecp synthase in complex with (i) cmp and (ii) cmp and product

PDB Compounds: (E:) 2c-methyl-d-erythritol-2,4-cyclodiphosphate synthase

SCOPe Domain Sequences for d1h47e1:

Sequence; same for both SEQRES and ATOM records:

>d1h47e1 d.79.5.1 (E:1-156) 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF {Escherichia coli [TaxId: 562]}
mrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdigkl
fpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiaedl
gchmddvnvkattteklgftgrgegiaceavallik

Timeline for d1h47e1:

• d1h47e1 first appeared in SCOP 1.71, called d1h47e_
  
• d1h47e1 appears in SCOPe 2.07