Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) |
Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (17 proteins) the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest C-terminal domains also show some similarity |
Protein Fatty oxidation complex alpha subunit, middle domain [110432] (1 species) |
Species Pseudomonas fragi [TaxId:296] [110433] (4 PDB entries) |
Domain d1wdlb3: 1wdl B:311-496 [109268] Other proteins in same PDB: d1wdla1, d1wdla2, d1wdla4, d1wdlb1, d1wdlb2, d1wdlb4, d1wdlc1, d1wdlc2, d1wdld1, d1wdld2 complexed with aco, n8e, nad |
PDB Entry: 1wdl (more details), 3.5 Å
SCOP Domain Sequences for d1wdlb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wdlb3 c.2.1.6 (B:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} akdvkqaavlgagimgggiayqsaskgtpilmkdinehgieqglaeaakllvgrvdkgrm tpakmaevlngirptlsygdfgnvdlvveavvenpkvkqavlaevenhvredailasnts tisisllakalkrpenfvgmhffnpvhmmplvevirgekssdlavattvayakkmgknpi vvndcp
Timeline for d1wdlb3: