SCOP 1.73: Domain d1wdlc2: 1wdl C:264-391

Lineage for d1wdlc2 (1wdl C:264-391)

Root: SCOP 1.73
Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

Fold c.95: Thiolase-like [53900] (1 superfamily)
consists of two similar domains related by pseudo dyad; duplication
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

Superfamily c.95.1: Thiolase-like [53901] (2 families)
Family c.95.1.1: Thiolase-related [53902] (8 proteins)
Protein Fatty oxidation complex beta subunit (3-ketoacyl-CoA thiolase) [110756] (1 species)
Species Pseudomonas fragi [TaxId:296] [110757] (4 PDB entries)
Domain d1wdlc2: 1wdl C:264-391 [109271]
Other proteins in same PDB: d1wdla1, d1wdla2, d1wdla3, d1wdla4, d1wdlb1, d1wdlb2, d1wdlb3, d1wdlb4

Details for d1wdlc2

PDB Entry: 1wdl (more details), 3.5 Å

PDB Description: fatty acid beta-oxidation multienzyme complex from Pseudomonas fragi, form II (native4)

PDB Compounds: (C:) 3-ketoacyl-CoA thiolase

SCOP Domain Sequences for d1wdlc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wdlc2 c.95.1.1 (C:264-391) Fatty oxidation complex beta subunit (3-ketoacyl-CoA thiolase) {Pseudomonas fragi [TaxId: 296]}
gleplavirsmavagvdpaimgygpvpatqkalkraglnmadidfielneafaaqalpvl
kdlkvldkmnekvnlhggaialghpfgcsgarisgtllnvmkqnggtfglstmciglgqg
iatvferv

SCOP Domain Coordinates for d1wdlc2:

Click to download the PDB-style file with coordinates for d1wdlc2.
(The format of our PDB-style files is described here.)

Timeline for d1wdlc2: