![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
![]() | Superfamily c.95.1: Thiolase-like [53901] (2 families) ![]() |
![]() | Family c.95.1.1: Thiolase-related [53902] (8 proteins) |
![]() | Protein Fatty oxidation complex beta subunit (3-ketoacyl-CoA thiolase) [110756] (1 species) |
![]() | Species Pseudomonas fragi [TaxId:296] [110757] (4 PDB entries) |
![]() | Domain d1wdlc2: 1wdl C:264-391 [109271] Other proteins in same PDB: d1wdla1, d1wdla2, d1wdla3, d1wdla4, d1wdlb1, d1wdlb2, d1wdlb3, d1wdlb4 |
PDB Entry: 1wdl (more details), 3.5 Å
SCOP Domain Sequences for d1wdlc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wdlc2 c.95.1.1 (C:264-391) Fatty oxidation complex beta subunit (3-ketoacyl-CoA thiolase) {Pseudomonas fragi [TaxId: 296]} gleplavirsmavagvdpaimgygpvpatqkalkraglnmadidfielneafaaqalpvl kdlkvldkmnekvnlhggaialghpfgcsgarisgtllnvmkqnggtfglstmciglgqg iatvferv
Timeline for d1wdlc2: