Lineage for d1wdlb2 (1wdl B:621-715)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 645590Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 645591Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (12 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 645632Family a.100.1.3: HCDH C-domain-like [48187] (2 proteins)
  6. 645633Protein Fatty oxidation complex alpha subunit, C-terminal domain [109949] (1 species)
    duplication: contains two repeats of this domain
  7. 645634Species Pseudomonas fragi [TaxId:296] [109950] (4 PDB entries)
  8. 645642Domain d1wdlb2: 1wdl B:621-715 [109267]
    Other proteins in same PDB: d1wdla3, d1wdla4, d1wdlb3, d1wdlb4, d1wdlc1, d1wdlc2, d1wdld1, d1wdld2
    complexed with aco, n8e, nad

Details for d1wdlb2

PDB Entry: 1wdl (more details), 3.5 Å

PDB Description: fatty acid beta-oxidation multienzyme complex from Pseudomonas fragi, form II (native4)
PDB Compounds: (B:) Fatty oxidation complex alpha subunit

SCOP Domain Sequences for d1wdlb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wdlb2 a.100.1.3 (B:621-715) Fatty oxidation complex alpha subunit, C-terminal domain {Pseudomonas fragi [TaxId: 296]}
dvtdediinwmmiplcletvrcledgivetaaeadmglvygigfplfrggalryidsigv
aefvaladqyaelgalyhptaklremakngqsffg

SCOP Domain Coordinates for d1wdlb2:

Click to download the PDB-style file with coordinates for d1wdlb2.
(The format of our PDB-style files is described here.)

Timeline for d1wdlb2: