Class b: All beta proteins [48724] (180 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) |
Family b.34.2.1: SH3-domain [50045] (40 proteins) |
Protein SH3-like domain of the L-type calcium channel [110158] (2 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [110160] (5 PDB entries) Uniprot P54287 38-362 |
Domain d1vyvb1: 1vyv B:71-215 [108920] Other proteins in same PDB: d1vyva2, d1vyvb2 beta4 isoform with odd numbering has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1vyv (more details), 3 Å
SCOPe Domain Sequences for d1vyvb1:
Sequence, based on SEQRES records: (download)
>d1vyvb1 b.34.2.1 (B:71-215) SH3-like domain of the L-type calcium channel {Norway rat (Rattus norvegicus) [TaxId: 10116]} airqereqqaaiqlerakskpvafavktnvsycgaldedvpvpssavsfdakdflhikek ynndwwigrlvkegceigfipsplrleniriqqeqkrkrfhggkssgnsssslgemvsgt fratptttakqkqkvtkhippydvv
>d1vyvb1 b.34.2.1 (B:71-215) SH3-like domain of the L-type calcium channel {Norway rat (Rattus norvegicus) [TaxId: 10116]} airqereqqaaiqlerakskpvafavktnvsycgaldedvpvpssavsfdakdflhikek ynndwwigrlvkegceigfipsplrleniriqqeqkrkhippydvv
Timeline for d1vyvb1: