PDB entry 1vyv

View 1vyv on RCSB PDB site
Description: beta4 subunit of ca2+ channel
Class: transport protein
Keywords: transport protein, ion transport/complex, calcium channel beta subunit, aid doamin, ion transport, ionic channel, voltage-gated channel, sh3 domain
Deposited on 2004-05-07, released 2004-06-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.248
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calcium channel beta-4subunit
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VYV
    Domains in SCOPe 2.07: d1vyva1, d1vyva2
  • Chain 'B':
    Compound: calcium channel beta-4subunit
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 1VYV
    Domains in SCOPe 2.07: d1vyvb1, d1vyvb2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vyvA (A:)
    gsadsytsrpsdsdvsleedreairqereqqaaiqlerakskpvafavktnvsycgalde
    dvpvpssavsfdakdflhikekynndwwigrlvkegceigfipsplrleniriqqeqkrk
    rfhggkssgnsssslgemvsgtfratptttakqkqkvtkhippydvvpsmrpvvlvgpsl
    kgyevtdmmqkalfdflkhrfdgrisitrvtadislakrsvlnnpskraiiersntkssl
    aevqseierifelarslqlvvldadtinhpaqliktslapiivhvkvsspkvlqrliksr
    gksqskhlnvqlvaadklaqcppemfdvildenqledacehlgeyleaywrathtssst
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vyvA (A:)
    airqereqqaaiqlerakskpvafavktnvsycgaldedvpvpssavsfdakdflhikek
    ynndwwigrlvkegceigfipsplrleniriqqeqkrkhippydvvpsmrpvvlvgpslk
    gyevtdmmqkalfdflkhrfdgrisitrvtadislaksslaevqseierifelarslqlv
    vldadtinhpaqliktslapiivhvkvsspkvlqrliksrgksqskhlnvqlvaadklaq
    cppemfdvildenqledacehlgeyleaywratht
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vyvB (B:)
    gsadsytsrpsdsdvsleedreairqereqqaaiqlerakskpvafavktnvsycgalde
    dvpvpssavsfdakdflhikekynndwwigrlvkegceigfipsplrleniriqqeqkrk
    rfhggkssgnsssslgemvsgtfratptttakqkqkvtkhippydvvpsmrpvvlvgpsl
    kgyevtdmmqkalfdflkhrfdgrisitrvtadislakrsvlnnpskraiiersntkssl
    aevqseierifelarslqlvvldadtinhpaqliktslapiivhvkvsspkvlqrliksr
    gksqskhlnvqlvaadklaqcppemfdvildenqledacehlgeyleaywrathtssst
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vyvB (B:)
    eairqereqqaaiqlerakskpvafavktnvsycgaldedvpvpssavsfdakdflhike
    kynndwwigrlvkegceigfipsplrleniriqqeqkrkhippydvvpsmrpvvlvgpsl
    kgyevtdmmqkalfdflkhrfdgrisitrvtadislaksslaevqseierifelarslql
    vvldadtinhpaqliktslapiivhvkvsspkvlqrliksrgksqskhlnvqlvaadkla
    qcppemfdvildenqledacehlgeyleaywratht