Lineage for d1vlca_ (1vlc A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1182016Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 1182017Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 1182018Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
    the active site is between the two identical subunits
  6. 1182019Protein 3-isopropylmalate dehydrogenase, IPMDH [53661] (10 species)
  7. 1182047Species Thermotoga maritima [TaxId:2336] [110714] (1 PDB entry)
    Uniprot Q9WZ26
  8. 1182048Domain d1vlca_: 1vlc A: [108743]
    Structural genomics target
    complexed with cl

Details for d1vlca_

PDB Entry: 1vlc (more details), 1.9 Å

PDB Description: crystal structure of 3-isopropylmalate dehydrogenase (tm0556) from thermotoga maritima at 1.90 a resolution
PDB Compounds: (A:) 3-isopropylmalate dehydrogenase

SCOPe Domain Sequences for d1vlca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vlca_ c.77.1.1 (A:) 3-isopropylmalate dehydrogenase, IPMDH {Thermotoga maritima [TaxId: 2336]}
kihhhhhhmkiavlpgdgigpevvrealkvlevvekktgktfekvfghiggdaidrfgep
lpeetkkicleadaiflgsvggpkwddlppekrpeiggllalrkmlnlyanirpikvyrs
lvhvsplkekvigsgvdlvtvrelsygvyygqprgldeekgfdtmiydrktveriartaf
eiaknrrkkvtsvdkanvlyssmlwrkvvnevareypdvelthiyvdnaamqlilkpsqf
dvilttnmfgdilsdesaalpgslgllpsasfgdknlyepaggsapdiagknianpiaqi
lslammlehsfgmveearkieravelvieegyrtrdiaedpekavstsqmgdlickklee
iw

SCOPe Domain Coordinates for d1vlca_:

Click to download the PDB-style file with coordinates for d1vlca_.
(The format of our PDB-style files is described here.)

Timeline for d1vlca_: