SCOPe 2.08: Domain d1vlca1: 1vlc A:1-354

Lineage for d1vlca1 (1vlc A:1-354)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
   consists of two intertwined (sub)domains related by pseudo dyad; duplication
   3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest

4. Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families)
   the constituent families form similar dimers

5. Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
   the active site is between the two identical subunits

6. Protein 3-isopropylmalate dehydrogenase, IPMDH [53661] (11 species)

7. Species Thermotoga maritima [TaxId:2336] [110714] (1 PDB entry)
   Uniprot Q9WZ26

8. Domain d1vlca1: 1vlc A:1-354 [108743]
   Other proteins in same PDB: d1vlca2
   Structural genomics target
   complexed with cl

Details for d1vlca1

PDB Entry: 1vlc, 1.9 Å

PDB Description: crystal structure of 3-isopropylmalate dehydrogenase (tm0556) from thermotoga maritima at 1.90 a resolution

PDB Compounds: (A:) 3-isopropylmalate dehydrogenase

SCOPe Domain Sequences for d1vlca1:

Sequence; same for both SEQRES and ATOM records:

>d1vlca1 c.77.1.1 (A:1-354) 3-isopropylmalate dehydrogenase, IPMDH {Thermotoga maritima [TaxId: 2336]}
mkiavlpgdgigpevvrealkvlevvekktgktfekvfghiggdaidrfgeplpeetkki
cleadaiflgsvggpkwddlppekrpeiggllalrkmlnlyanirpikvyrslvhvsplk
ekvigsgvdlvtvrelsygvyygqprgldeekgfdtmiydrktveriartafeiaknrrk
kvtsvdkanvlyssmlwrkvvnevareypdvelthiyvdnaamqlilkpsqfdvilttnm
fgdilsdesaalpgslgllpsasfgdknlyepaggsapdiagknianpiaqilslammle
hsfgmveearkieravelvieegyrtrdiaedpekavstsqmgdlickkleeiw

Timeline for d1vlca1:

• d1vlca1 first appeared in SCOP 1.69, called d1vlca_
  
• d1vlca1 appears in SCOPe 2.07