Lineage for d1vddc_ (1vdd C:)

  1. Root: SCOP 1.75
  2. 883176Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 885755Fold e.49: Recombination protein RecR [111303] (1 superfamily)
    consists of three domains: alpha-helical dimerisation domain (res. 1-53) with HhH motif; 'treble cleft' C4 zinc-finger domain (54-76); and Toprim domain (76-199; segment-swapped dimer)
  4. 885756Superfamily e.49.1: Recombination protein RecR [111304] (1 family) (S)
  5. 885757Family e.49.1.1: Recombination protein RecR [111305] (1 protein)
    three sequential domains correspond to Pfam PF00633, Pfam PF02132 and Pfam PF01751, respectively
  6. 885758Protein Recombination protein RecR [111306] (1 species)
  7. 885759Species Deinococcus radiodurans [TaxId:1299] [111307] (2 PDB entries)
    Uniprot Q9ZNA2
  8. 885762Domain d1vddc_: 1vdd C: [108521]

Details for d1vddc_

PDB Entry: 1vdd (more details), 2.5 Å

PDB Description: crystal structure of recombinational repair protein recr
PDB Compounds: (C:) recombination protein recr

SCOP Domain Sequences for d1vddc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vddc_ e.49.1.1 (C:) Recombination protein RecR {Deinococcus radiodurans [TaxId: 1299]}
kyppslvslirelsrlpgigpksaqrlafhlfeqpredierlasalleakrdlhvcpicf
nitdaekcdvcadpsrdqrticvveepgdvialersgeyrglyhvlhgvlspmngvgpdk
lhikpllprvgqgmevilatgttvegdatalylqrlleplgaaisriaygvpvggsleyt
devtlgraltgrqtvs

SCOP Domain Coordinates for d1vddc_:

Click to download the PDB-style file with coordinates for d1vddc_.
(The format of our PDB-style files is described here.)

Timeline for d1vddc_: