![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
![]() | Fold e.49: Recombination protein RecR [111303] (1 superfamily) consists of three domains: alpha-helical dimerisation domain (res. 1-53) with HhH motif; 'treble cleft' C4 zinc-finger domain (54-76); and Toprim domain (76-199; segment-swapped dimer) |
![]() | Superfamily e.49.1: Recombination protein RecR [111304] (2 families) ![]() |
![]() | Family e.49.1.1: Recombination protein RecR [111305] (1 protein) three sequential domains correspond to Pfam PF00633, Pfam PF02132 and Pfam PF01751, respectively |
![]() | Protein Recombination protein RecR [111306] (2 species) |
![]() | Species Deinococcus radiodurans [TaxId:1299] [111307] (2 PDB entries) Uniprot Q9ZNA2 |
![]() | Domain d1vddc_: 1vdd C: [108521] complexed with imd, zn |
PDB Entry: 1vdd (more details), 2.5 Å
SCOPe Domain Sequences for d1vddc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vddc_ e.49.1.1 (C:) Recombination protein RecR {Deinococcus radiodurans [TaxId: 1299]} kyppslvslirelsrlpgigpksaqrlafhlfeqpredierlasalleakrdlhvcpicf nitdaekcdvcadpsrdqrticvveepgdvialersgeyrglyhvlhgvlspmngvgpdk lhikpllprvgqgmevilatgttvegdatalylqrlleplgaaisriaygvpvggsleyt devtlgraltgrqtvs
Timeline for d1vddc_: