![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (46 folds) |
![]() | Fold e.49: Recombination protein RecR [111303] (1 superfamily) consists of three domains: alpha-helical dimerisation domain (res. 1-53) with HhH motif (Pfam 00633); 'treble cleft' C4 zinc-finger domain (54-76; Pfam 02132); and Toprim domain (76-199; segment-swapped dimer; Pfam 01751) |
![]() | Superfamily e.49.1: Recombination protein RecR [111304] (1 family) ![]() |
![]() | Family e.49.1.1: Recombination protein RecR [111305] (1 protein) |
![]() | Protein Recombination protein RecR [111306] (1 species) |
![]() | Species Deinococcus radiodurans [TaxId:1299] [111307] (1 PDB entry) |
![]() | Domain d1vddc_: 1vdd C: [108521] |
PDB Entry: 1vdd (more details), 2.5 Å
SCOP Domain Sequences for d1vddc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vddc_ e.49.1.1 (C:) Recombination protein RecR {Deinococcus radiodurans} kyppslvslirelsrlpgigpksaqrlafhlfeqpredierlasalleakrdlhvcpicf nitdaekcdvcadpsrdqrticvveepgdvialersgeyrglyhvlhgvlspmngvgpdk lhikpllprvgqgmevilatgttvegdatalylqrlleplgaaisriaygvpvggsleyt devtlgraltgrqtvs
Timeline for d1vddc_: