Lineage for d1vcoa2 (1vco A:11-282)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2869013Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 2869097Protein CTP synthase PyrG, N-terminal domain [110551] (3 species)
  7. 2869104Species Thermus thermophilus [TaxId:274] [110553] (3 PDB entries)
    Uniprot Q5SIA8
  8. 2869105Domain d1vcoa2: 1vco A:11-282 [108509]
    Other proteins in same PDB: d1vcoa1
    complexed with gln

Details for d1vcoa2

PDB Entry: 1vco (more details), 2.15 Å

PDB Description: Crystal Structure of T.th. HB8 CTP synthetase complex with Glutamine
PDB Compounds: (A:) CTP synthetase

SCOPe Domain Sequences for d1vcoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vcoa2 c.37.1.10 (A:11-282) CTP synthase PyrG, N-terminal domain {Thermus thermophilus [TaxId: 274]}
prkyvfitggvvsslgkgiltsslgallrargyrvtaikidpyvnvdagtmrpyehgevf
vtadgaetdldighyerfldmdlsrgnnlttgqvylsviqkerrgeylsqtvqviphitd
eikerirkvaeeqkaeivvvevggtvgdieslpfleairqfrfdegegntlylhltlvpy
letseefktkptqhsvatlrgvgiqpdilvlrsarpvpeevrrkvalftnvrpghvfssp
tvehlyevpllleeqglgraveralgleavip

SCOPe Domain Coordinates for d1vcoa2:

Click to download the PDB-style file with coordinates for d1vcoa2.
(The format of our PDB-style files is described here.)

Timeline for d1vcoa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vcoa1