![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) ![]() conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
![]() | Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 proteins) contains a catalytic Cys-His-Glu triad |
![]() | Protein CTP synthase PyrG, C-terminal domain [110481] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [110483] (3 PDB entries) Uniprot Q5SIA8 |
![]() | Domain d1vcoa1: 1vco A:298-547 [108508] Other proteins in same PDB: d1vcoa2 complexed with gln |
PDB Entry: 1vco (more details), 2.15 Å
SCOPe Domain Sequences for d1vcoa1:
Sequence, based on SEQRES records: (download)
>d1vcoa1 c.23.16.1 (A:298-547) CTP synthase PyrG, C-terminal domain {Thermus thermophilus [TaxId: 274]} ertvkiaiagkyvkmpdaylsllealrhagiknrarvevkwvdaesleaadleeafrdvs gilvpggfgvrgiegkvraaqyarerkipylgiclglqiaviefarnvaglkganstefd phtphpvidlmpeqleveglggtmrlgdwpmrikpgtllhrlygkeevlerhrhryevnp lyvdgleraglvvsattpgmrgrgaglveaielkdhpfflglqshpefksrpmrpsppfv gfveaalayq
>d1vcoa1 c.23.16.1 (A:298-547) CTP synthase PyrG, C-terminal domain {Thermus thermophilus [TaxId: 274]} ertvkiaiagkyvdaylsllealrhagiknrarvevkwvdaesladleeafrdvsgilvp ggfgvrgiegkvraaqyarerkipylgiclglqiaviefarnvaglkganstefdphtph pvidlmpeqlevggtmrlgdwpmrikpgtllhrlygkeevlerhrhryevnplyvdgler aglvvsattpgmrgrgaglveaielkdhpfflglqshpefksrpmrpsppfvgfveaala yq
Timeline for d1vcoa1: