SCOPe 2.01: Domain d1v8xc_: 1v8x C:

Lineage for d1v8xc_ (1v8x C:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (5 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins)

6. Protein Heme oxygenase HmuO [89159] (1 species)

7. Species Corynebacterium diphtheriae [TaxId:1717] [89160] (12 PDB entries)
   Uniprot P71119

8. Domain d1v8xc_: 1v8x C: [108434]
   complexed with hem, oxy, so4, suc

Details for d1v8xc_

PDB Entry: 1v8x, 1.85 Å

PDB Description: crystal structure of the dioxygen-bound heme oxygenase from corynebacterium diphtheriae

PDB Compounds: (C:) Heme oxygenase

SCOPe Domain Sequences for d1v8xc_:

Sequence; same for both SEQRES and ATOM records:

>d1v8xc_ a.132.1.1 (C:) Heme oxygenase HmuO {Corynebacterium diphtheriae [TaxId: 1717]}
aglavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqavdavra
sgfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnvdgpal
vahhyvrylgdlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyreklnnlel
sdeqrehllkeatdafvfnhqvfadlgk

Timeline for d1v8xc_:

• d1v8xc_ first appeared in SCOP 1.69
  
• d1v8xc_ appears in SCOP 1.75
  
• d1v8xc_ appears in SCOPe 2.02
  
• d1v8xc_ appears in the current release, SCOPe 2.08