Lineage for d1v8xc_ (1v8x C:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 777762Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 777763Superfamily a.132.1: Heme oxygenase-like [48613] (4 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 777764Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (3 proteins)
  6. 777773Protein Heme oxygenase HmuO [89159] (1 species)
  7. 777774Species Corynebacterium diphtheriae [TaxId:1717] [89160] (10 PDB entries)
    Uniprot P71119
  8. 777787Domain d1v8xc_: 1v8x C: [108434]
    complexed with hem, oxy, so4, suc

Details for d1v8xc_

PDB Entry: 1v8x (more details), 1.85 Å

PDB Description: crystal structure of the dioxygen-bound heme oxygenase from corynebacterium diphtheriae
PDB Compounds: (C:) Heme oxygenase

SCOP Domain Sequences for d1v8xc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v8xc_ a.132.1.1 (C:) Heme oxygenase HmuO {Corynebacterium diphtheriae [TaxId: 1717]}
aglavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqavdavra
sgfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnvdgpal
vahhyvrylgdlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyreklnnlel
sdeqrehllkeatdafvfnhqvfadlgk

SCOP Domain Coordinates for d1v8xc_:

Click to download the PDB-style file with coordinates for d1v8xc_.
(The format of our PDB-style files is described here.)

Timeline for d1v8xc_: