Lineage for d1v8xc_ (1v8x C:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins)
    automatically mapped to Pfam PF01126
  6. Protein Heme oxygenase HmuO [89159] (1 species)
  7. Species Corynebacterium diphtheriae [TaxId:1717] [89160] (16 PDB entries)
    Uniprot P71119
  8. Domain d1v8xc_: 1v8x C: [108434]
    complexed with hem, oxy, so4

Details for d1v8xc_

PDB Entry: 1v8x (more details), 1.85 Å

PDB Description: crystal structure of the dioxygen-bound heme oxygenase from corynebacterium diphtheriae
PDB Compounds: (C:) Heme oxygenase

SCOPe Domain Sequences for d1v8xc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v8xc_ a.132.1.1 (C:) Heme oxygenase HmuO {Corynebacterium diphtheriae [TaxId: 1717]}
aglavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqavdavra
sgfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnvdgpal
vahhyvrylgdlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyreklnnlel
sdeqrehllkeatdafvfnhqvfadlgk

SCOPe Domain Coordinates for d1v8xc_ are not available.

Timeline for d1v8xc_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1v8xa_, d1v8xb_