Lineage for d1v87a_ (1v87 A:)

  1. Root: SCOPe 2.02
  2. 1239924Class g: Small proteins [56992] (90 folds)
  3. 1245811Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 1245812Superfamily g.44.1: RING/U-box [57850] (7 families) (S)
  5. 1245813Family g.44.1.1: RING finger domain, C3HC4 [57851] (14 proteins)
  6. 1245832Protein Deltex protein 2 RING-H2 domain [111457] (1 species)
  7. 1245833Species Mouse (Mus musculus) [TaxId:10090] [111458] (1 PDB entry)
    Uniprot Q8R3P2 389-489
  8. 1245834Domain d1v87a_: 1v87 A: [108422]
    Structural genomics target
    C-terminal RING domain; one zinc ion-bound structure adopts a different fold; misfolded conformation (?)
    complexed with zn

Details for d1v87a_

PDB Entry: 1v87 (more details)

PDB Description: solution structure of the ring-h2 finger domain of mouse deltex protein 2
PDB Compounds: (A:) Deltex protein 2

SCOPe Domain Sequences for d1v87a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgepeqvirkyteelkvapeedciicmeklavasgysdmtdskalgpmvvgrltk
cshafhllcllamycngnkdgslqcpscktiygektgtqpwgkmevfrsgpssg

SCOPe Domain Coordinates for d1v87a_:

Click to download the PDB-style file with coordinates for d1v87a_.
(The format of our PDB-style files is described here.)

Timeline for d1v87a_: